Clik here to view.
Asfotase alfa
> Asfotase Alfa Sequence LVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQL HHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERS...
View ArticleClik here to view.
Idarucizumab
Idarucizumab (Praxbind®) Approved An antidote for rapid reversal of dabigatran-induced anticoagulation indicated for emergency surgery (urgent procedures) and life-threatening or uncontrolled...
View ArticleClik here to view.
Daratumumab
Daratumumab (Darzalex®)Approved An anti-CD38 monoclonal antibody used to treat multiple myeloma. Research Code HuMax-CD-38; HuMaxCD-38 CAS No. Daratumumab (HuMax®-CD38) Daratumumab (Darzalex) is an...
View ArticleClik here to view.
Albutrepenonacog alfa
1YNSGKLEEFV QGNLERECME EKCSFEEARE VFENTERTTE FWKQYVDGDQ 51CESNPCLNGG SCKDDINSYE CWCPFGFEGK NCELDVTCNI KNGRCEQFCK 101NSADNKVVCS CTEGYRLAEN QKSCEPAVPF PCGRVSVSQT SKLTRAETVF 151PDVDYVNSTE AETILDNITQ...
View ArticleClik here to view.
New Patent, Tedizolid phosphate, Suzhou MiracPharma Technology Co Ltd, Zheren...
Tedizolid phosphate Suzhou MiracPharma Technology Co Ltd; Zheren Pharmaceutical Nanjing Co Ltd WO-2016058467 click for patent SUZHOU MIRACPHARMA TECHNOLOGY CO., LTD [CN/CN]; Room 1305, Building 1...
View ArticleClik here to view.
Lurasidone hydrochloride, Jubilant Generics Ltd, WO 2016059649, New patent
Lurasidone Lurasidone hydrochloride, Jubilant Life Sciences Ltd, WO 2016059649, New patent An improved process for the preparation of lurasidone hydrochloride Jubilant Life Sciences Ltd WO...
View ArticleClik here to view.
FDA releases draft guidance on the use of comparability protocols for post...
The US FDA released a draft guidance for industry “Comparability Protocols for Human Drugs and Biologics: Chemistry, Manufacturing, and Controls Information”. The guidance replaces the draft...
View ArticleClik here to view.
Five new General Chapters in the European Pharmacopoeia on Genotoxic...
During the manufacture of APIs as sulfonate salts, esters of sulfonic acid may develop in undesired chemical side reactions. Recently, five new General Monographs have been included in the European...
View ArticleClik here to view.
New FDA Draft Guidance ‘Data Integrity and Compliance with cGMP’ published
In the last years, the topic “data integrity” has become a priority for the FDA. Recently, the Agency has published the draft of a Guidance for Industry on the topic which presents the comprehensive...
View ArticleClik here to view.
энкломифен Enclomiphene citrate إينكلوميفان
Enclomiphene citrate NDA FILED Hypogonadism, Repros Therapeutics An estrogen receptor (ER) antagonist potentially for treatment of hypogonadotropic hypogonadism. ICI-46476; RMI-16289 CAS...
View ArticleClik here to view.
Cymipristone
Cymipristone (8S,11R,13S,14S,17S)-11-{4-[Cyclohexyl(méthyl)amino]phényl}-17-hydroxy-13-méthyl-17-(1-propyn-1-yl)-1,2,6,7,8,11,12,13,14,15,16,17-dodécahydro-3H-cyclopenta[a]phénanthrén-3-one...
View ArticleClik here to view.
VX-? , an Azaindolyl-Pyrimidine Inhibitor of Influenza Virus Replication from...
VX-? An Azaindolyl-Pyrimidine Inhibitor of Influenza Virus Replication from Vertex SYNTHESIS COMING…….. CAS 1259498-06-0 C23 H27 F2 N7 O, Molecular Weight, 455.50 1-Piperidinecarboxamide,...
View ArticleClik here to view.
ImmunoPET Imaging of Insulin-Like Growth Factor 1 Receptor in a Subcutaneous...
The role of insulin-like growth factor-1 receptor (IGF-1R) in cancer tumorigenesis was established decades ago, yet there are limited studies evaluating the imaging and therapeutic properties of...
View ArticleClik here to view.
SQ 109, Pyrrole Hybrid Derivatives, Potent Antitubercular Agents Effective...
Novel pyrroles have been designed, synthesized, and evaluated against mycobacterial strains. The pyrroles have originally been designed as hybrids of the antitubercular drugs BM212 (1) and SQ109...
View ArticleClik here to view.
Cebranopadol hemicitrate, セブラノパドール
Cebranopadol hemicitrate, GRT-6005 Phase III Grünenthal GmbH innovator SYNTHESIS COMING WATCH OUT………. A mu-opioid agonist for treatment of neuropathic pain and pain due to osteoarthritis. CAS...
View ArticleClik here to view.
Clik here to view.
Elpamotide
Elpamotide str drawn bt worlddrugtracker Elpamotide L-Arginyl-L-phenylalanyl-L-valyl-L-prolyl-L-alpha-aspartylglycyl-L-asparaginyl-L-arginyl-L-isoleucine human soluble (Vascular Endothelial Growth...
View ArticleClik here to view.
Optimization of thermosensitive chitosan hydrogels for the sustained delivery...
Optimization of thermosensitive chitosan hydrogels for the sustained delivery of venlafaxine hydrochloride Original Research Article Pages 482-490 Ying Peng, Jie Li, Jing Li, Yin Fei, Jiangnan...
View ArticleClik here to view.
Boldenone Undecylenate
Boldenone Undecylenate cas 13103-34-9, C30 H44 O3, 452.67 Androsta-1,4-dien-3-one, 17-[(1-oxo-10-undecenyl)oxy]-, (17β)- Androsta-1,4-dien-3-one, 17β-hydroxy-, 10-undecenoate (7CI,8CI)...
View ArticleClik here to view.
Galunisertib
Galunisertib Phase III A TGF-beta receptor type-1 inhibitor potentially for the treatment of myelodysplastic syndrome (MDS) and solid tumours. LY-2157299 CAS No.700874-72-2...
View Article